General Information

  • ID:  hor006798
  • Uniprot ID:  A1YL74??24-132)
  • Protein name:  Agouti-signaling protein
  • Gene name:  ASIP
  • Organism:  Trachypithecus francoisi
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Cercopithecoidea; Cercopithecidae (Old World monkeys); Colobinae; Trachypithecus (leaf monkeys); Trachypithecus francoisi (Francois' leaf monkey) (Presbytis francoisi)
  • GO MF:  GO:0005615 extracellular space
  • GO BP:  GO:0031779 melanocortin receptor binding; GO:0005184 neuropeptide hormone activity
  • GO CC:  GO:0009755 hormone-mediated signaling pathway; GO:0042438 melanin biosynthetic process; GO:0032438 melanosome organization; GO:0048023 positive regulation of melanin biosynthetic process

Sequence Information

  • Sequence:  LPPEEKLRDDRSLRSNSSVNLLDFPSVSIVALNKKSKQISRKEAEKKRSSKKEASMKKVAQPRTPLSAPCVATRDSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC
  • Length:  109
  • Propeptide:  MDVTRLLLATLLVFLCFFTVYSHLPPEEKLRDDRSLRSNSSVNLLDFPSVSIVALNKKSKQISRKEAEKKRSSKKEASMKKVAQPRTPLSAPCVATRDSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC
  • Signal peptide:  MDVTRLLLATLLVFLCFFTVYS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment)
  • Mechanism:  The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown/black pigment) and thus increasing synthesis of pheomelanin (yellow/red pigment)
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA